DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scp1 and AT4G27790

DIOPT Version :10

Sequence 1:NP_001015389.1 Gene:Scp1 / 3355102 FlyBaseID:FBgn0020908 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_194508.1 Gene:AT4G27790 / 828892 AraportID:AT4G27790 Length:345 Species:Arabidopsis thaliana


Alignment Length:194 Identity:47/194 - (24%)
Similarity:74/194 - (38%) Gaps:80/194 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DIDNNGFLD---QNDFLCMAVRACVVEGKGDCSTARLDDYKKLMKNLWDEISAIADDDKDGKISN 79
            |.|:||.||   .|:||             ....:|..|.::.:  |.:.::.: |.:.|||:  
plant   183 DFDHNGSLDIEEFNNFL-------------HPEDSRNGDTQRWV--LKERMTGM-DTNGDGKL-- 229

  Fly    80 QEFKDAVKKTCVGKKYEEF-------------PQAMRAFIESNFKLLDIDSDGIVGVKEYRYNCI 131
             |:|:.||...  :.|:||             ||.:       |..:|.|.|        |:   
plant   230 -EYKEFVKNAY--EMYKEFAKFEKEEDENVPTPQLL-------FAEMDRDKD--------RF--- 273

  Fly   132 TRVAIDDITPI-----------DKAFETLL---NDEDRKRGGLSLDR--------YKELYGQFL 173
              :..|::.||           .|.:.|.|   .||| |.|.|||:.        ||.::.:.|
plant   274 --LVADELRPILQYLQPGEMSYAKFYSTFLCHEADED-KDGKLSLEEMLHHEDVFYKAVHHEDL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Scp1NP_001015389.1 FRQ1 16..>127 CDD:444056 29/124 (23%)
AT4G27790NP_194508.1 EFh_CREC 95..325 CDD:330175 44/183 (24%)
EF-hand motif 95..125 CDD:320021
EF-hand motif 132..160 CDD:320021
EF-hand motif 177..203 CDD:320021 9/32 (28%)
EF-hand motif 213..245 CDD:320021 10/39 (26%)
EF-hand motif 259..290 CDD:320021 10/50 (20%)
EF-hand motif 297..325 CDD:320021 10/28 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.