DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scp1 and cam1

DIOPT Version :9

Sequence 1:NP_001015389.1 Gene:Scp1 / 3355102 FlyBaseID:FBgn0020908 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_593340.1 Gene:cam1 / 2543039 PomBaseID:SPAC3A12.14 Length:150 Species:Schizosaccharomyces pombe


Alignment Length:111 Identity:26/111 - (23%)
Similarity:45/111 - (40%) Gaps:27/111 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DIDNNGFLDQNDFLCMAVRACVVEGKGDCSTARLDDYKKLMKNLWDEISAIADDDKDGKISNQEF 82
            |.|.||.:|..:||.|..|...       .|...::.::..|        :.|.|.:|.|:.:|.
pombe    58 DADGNGTIDFTEFLTMMARKMK-------DTDNEEEVREAFK--------VFDKDGNGYITVEEL 107

  Fly    83 KDAVKKTCVGKK--YEEFPQAMRAFIESNFKLLDIDSDGIVGVKEY 126
            ...:  |.:|::  .||....:|.        .|.|.||::..:|:
pombe   108 THVL--TSLGERLSQEEVADMIRE--------ADTDGDGVINYEEF 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Scp1NP_001015389.1 EF-hand_7 15..86 CDD:290234 16/67 (24%)
EFh 16..87 CDD:298682 16/68 (24%)
EF-hand_7 58..128 CDD:290234 16/71 (23%)
EFh 70..125 CDD:298682 14/56 (25%)
cam1NP_593340.1 PTZ00184 5..150 CDD:185504 26/111 (23%)
EFh 13..75 CDD:238008 8/16 (50%)
EFh 86..148 CDD:238008 16/76 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.