DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scp1 and cex-2

DIOPT Version :9

Sequence 1:NP_001015389.1 Gene:Scp1 / 3355102 FlyBaseID:FBgn0020908 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001366698.1 Gene:cex-2 / 188309 WormBaseID:WBGene00023408 Length:189 Species:Caenorhabditis elegans


Alignment Length:182 Identity:42/182 - (23%)
Similarity:77/182 - (42%) Gaps:29/182 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YDIDNNGFLDQNDFLCMAVRACVVEGKGDCSTARLDDY---KKLMKNLWDEISAIADDDKDGKIS 78
            :|:|.||.::..||      ..::|..|:....|.|.:   :..:.::|.:::.....:::..|:
 Worm    24 FDLDQNGLIEWKDF------KDLIEVIGEVRGRRSDFFMTARLCLPDIWQKMTEAIGKEEEDIIT 82

  Fly    79 NQEFKDAVKKTCVGKKYEEFPQAMRAFIESNFKLLDIDSDGIVGVKEY----RYNCITRVAIDDI 139
               ..|.::.....:|....|...:|::|..|||||...|.:|...||    .|..:.|.  |..
 Worm    83 ---LSDWIQLCQSSRKSVREPAWQKAYVEYMFKLLDESGDHLVDQAEYVQVLGYFGVNRK--DSS 142

  Fly   140 TPIDK-AFE---TLLNDEDRKRGGLSLDRYKELYGQFLGNTADNHPAVNLFG 187
            ...|: ||.   .|:|..|:|       ::..|:.||..:...:.|...|.|
 Worm   143 HCFDQFAFNHQGQLINSIDKK-------KFHVLWKQFFHSEDPSSPGNWLLG 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Scp1NP_001015389.1 EF-hand_7 15..86 CDD:290234 13/71 (18%)
EFh 16..87 CDD:298682 13/72 (18%)
EF-hand_7 58..128 CDD:290234 16/73 (22%)
EFh 70..125 CDD:298682 13/54 (24%)
cex-2NP_001366698.1 FRQ1 15..>131 CDD:227455 26/115 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.