DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scp1 and calu-2

DIOPT Version :10

Sequence 1:NP_001015389.1 Gene:Scp1 / 3355102 FlyBaseID:FBgn0020908 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_491936.3 Gene:calu-2 / 184174 WormBaseID:WBGene00017240 Length:286 Species:Caenorhabditis elegans


Alignment Length:204 Identity:47/204 - (23%)
Similarity:89/204 - (43%) Gaps:56/204 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DIDNNGFLDQNDFLCMAVRACVVEGKGDCSTARLDDYKKLM-KNLWDEISAIADDDKDGKISNQE 81
            |.:|:||:|:::.|     |.|.|           .|:|.: :...:.||.: |::.||.:|.:|
 Worm    58 DTNNDGFVDKSEIL-----AWVSE-----------SYQKTVDREAVERISEL-DENADGFVSWEE 105

  Fly    82 F-KDAVKKTCVGKKYEEFPQAMRAFIESNFKLLDIDSDGIVGVKEY------RYNCITRVAIDDI 139
            : .|:.....:..|.||   ::.|..:..||..|.|:||.:.::|.      .::......:..:
 Worm   106 YLADSFPDEELHNKEEE---SLIAQDKMYFKQADEDNDGKLNLEELASFLNPEHHPHMHPVLIAV 167

  Fly   140 TPIDK------AFE--TLLNDEDRKRGG----LSLDRYKELY---------GQFL-------GNT 176
            |.::|      |.|  ..|.:.|.:||.    :.::|::.:|         |..|       |.|
 Worm   168 TLLEKDQNGDGAIEEKEFLGELDEQRGSEWYKVEVERFRTVYDKNKDGKLAGDELTDWLLVDGTT 232

  Fly   177 ADNHPAVNL 185
            |.::.|.:|
 Worm   233 AGSYEAESL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Scp1NP_001015389.1 FRQ1 16..>127 CDD:444056 30/116 (26%)
calu-2NP_491936.3 EFh_CREC 54..265 CDD:330175 47/204 (23%)
EF-hand motif 54..78 CDD:320021 9/35 (26%)
EF-hand motif 85..114 CDD:320021 8/29 (28%)
EF-hand motif 127..156 CDD:320021 7/28 (25%)
EF-hand motif 164..193 CDD:320021 6/28 (21%)
EF-hand motif 201..230 CDD:320021 4/28 (14%)
EF-hand motif 237..265 CDD:320021 2/5 (40%)

Return to query results.
Submit another query.