DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and CGB7

DIOPT Version :9

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001372190.1 Gene:CGB7 / 94027 HGNCID:16451 Length:165 Species:Homo sapiens


Alignment Length:85 Identity:15/85 - (17%)
Similarity:26/85 - (30%) Gaps:28/85 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PVCVHAQRQL-------VVAILKNCHPKAEDSVSKYQ---------------------YMEAVNC 131
            |||:.....:       :..:|:...|.....|..|:                     |..|::|
Human    44 PVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSC 108

  Fly   132 HCQTCSTQDTSCEAPANNEM 151
            .|..|....|.|..|.::.:
Human   109 QCALCRRSTTDCGGPKDHPL 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 13/76 (17%)
CGB7NP_001372190.1 GHB 25..131 CDD:214502 15/85 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144399
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362225at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11515
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.