DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and TSHB

DIOPT Version :9

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_000540.2 Gene:TSHB / 7252 HGNCID:12372 Length:138 Species:Homo sapiens


Alignment Length:119 Identity:28/119 - (23%)
Similarity:46/119 - (38%) Gaps:20/119 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RRVYTYKVTQSDLQGHECWDYVSVWSCWGRCDSSEISDWKF-PYKRSFHPVCVHAQRQLVVAILK 110
            ||...|.:|            ::...|.|.|.:.:|:...| |.......||.:  |..:...::
Human    33 RRECAYCLT------------INTTICAGYCMTRDINGKLFLPKYALSQDVCTY--RDFIYRTVE 83

  Fly   111 NCHPKAEDSVSKY-QYMEAVNCHCQTCSTQDTSC--EAPANNEMAGGSRAIMVG 161
              .|.....|:.| .|..|::|.|..|:|..:.|  ||...|......::.:||
Human    84 --IPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVG 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 23/100 (23%)
TSHBNP_000540.2 GHB 18..126 CDD:214502 26/108 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362225at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11515
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.