powered by:
Protein Alignment Gpb5 and lhb
DIOPT Version :9
Sequence 1: | NP_001104334.1 |
Gene: | Gpb5 / 3355097 |
FlyBaseID: | FBgn0063368 |
Length: | 169 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_991185.1 |
Gene: | lhb / 402917 |
ZFINID: | ZDB-GENE-040806-2 |
Length: | 140 |
Species: | Danio rerio |
Alignment Length: | 71 |
Identity: | 15/71 - (21%) |
Similarity: | 29/71 - (40%) |
Gaps: | 4/71 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 CWGRCDSSEISDWKFPYKRSFHPVCVHAQRQLVVAILKNCHPKAEDSVSKYQYMEAVNCHCQTCS 137
|.|.|.:.: ..:|.|:......||.:...:.....|.:|....:..:: |..|::|.|..|:
Zfish 54 CSGHCVTRD-PVYKSPFSTVHQTVCTYRDVRYETINLPDCSAGVDPQIT---YPVALSCDCSLCT 114
Fly 138 TQDTSC 143
...:.|
Zfish 115 INTSDC 120
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170577503 |
Domainoid |
1 |
1.000 |
46 |
1.000 |
Domainoid score |
I12097 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
49 |
1.000 |
Inparanoid score |
I5467 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1362225at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR11515 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
7 | 7.000 |
|
Return to query results.
Submit another query.