DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and LHB

DIOPT Version :9

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_000885.1 Gene:LHB / 3972 HGNCID:6584 Length:141 Species:Homo sapiens


Alignment Length:56 Identity:13/56 - (23%)
Similarity:23/56 - (41%) Gaps:3/56 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 VCVHAQRQLVVAILKNCHPKAEDSVSKYQYMEAVNCHCQTCSTQDTSCEAPANNEM 151
            ||.:...:.....|..| |:..|.|..:..  |::|.|..|....:.|..|.::.:
Human    76 VCTYRDVRFESIRLPGC-PRGVDPVVSFPV--ALSCRCGPCRRSTSDCGGPKDHPL 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 11/47 (23%)
LHBNP_000885.1 GHB 25..131 CDD:214502 13/56 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144398
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362225at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11515
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.