DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and Gphb5

DIOPT Version :9

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001007014.1 Gene:Gphb5 / 366668 RGDID:1359264 Length:129 Species:Rattus norvegicus


Alignment Length:133 Identity:42/133 - (31%)
Similarity:68/133 - (51%) Gaps:11/133 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IFVGTSVVLVSVSSSSLSEIKPMNNGHIVTPLGCHRRVYTYKVTQSDLQGHECWDYVSVWSCWGR 76
            :.:||:.:|:..|.|.||.    ::|::.|.:||..|.:|:...:...:|..    ::..:||||
  Rat     6 LVLGTAALLLGGSDSVLSS----SSGNLHTFVGCAVREFTFVAKKPGCRGLR----ITTDACWGR 62

  Fly    77 CDSSEISDWKFPYKRSFHPVCVHAQRQLVVAILKNCHPKAEDSVSKYQYMEAVNCHCQTCSTQDT 141
            |::.|....:.||..::|.||.:.:.:.|...|.||.|..:..   |.|..||.|.|..|||..|
  Rat    63 CETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPF---YTYPMAVRCDCGACSTATT 124

  Fly   142 SCE 144
            .||
  Rat   125 ECE 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 30/98 (31%)
Gphb5NP_001007014.1 GHB_like 35..128 CDD:200450 32/100 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338113
Domainoid 1 1.000 59 1.000 Domainoid score I10466
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5205
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362225at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto96995
orthoMCL 1 0.900 - - OOG6_109629
Panther 1 1.100 - - O PTHR11515
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.