DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and tshba

DIOPT Version :9

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_021332467.1 Gene:tshba / 353223 ZFINID:ZDB-GENE-030513-3 Length:182 Species:Danio rerio


Alignment Length:118 Identity:30/118 - (25%)
Similarity:51/118 - (43%) Gaps:20/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 HIVTPLGCHRRVYTYKVTQSD----LQGHECWDY---VSVWSCWGRC---DSS--EISDWKFPYK 90
            :::..||...:|.......:|    ::..|| :|   |:...|.|.|   ||:  |:...:|..:
Zfish    39 YVIGMLGLLMKVAVPMCAPTDYTIYIERQEC-NYCVAVNTTICMGFCFSRDSNIKELVGPRFIVQ 102

  Fly    91 RSFHPVCVHAQRQLVVAILKNCHPKAEDSVSKYQYMEAVNCHCQTCSTQDTSC 143
            |.    |.:.:.:...|:|..|...|:   ..:.|..|::|||.||.|....|
Zfish   103 RG----CTYQEVEYRTAVLPGCPSHAD---PHFTYPVALSCHCSTCKTHSDEC 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 28/111 (25%)
tshbaXP_021332467.1 GHB 51..160 CDD:214502 27/106 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577506
Domainoid 1 1.000 46 1.000 Domainoid score I12097
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5467
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362225at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11515
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.