DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and Tshb

DIOPT Version :9

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_037248.2 Gene:Tshb / 25653 RGDID:3910 Length:138 Species:Rattus norvegicus


Alignment Length:107 Identity:25/107 - (23%)
Similarity:38/107 - (35%) Gaps:20/107 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RRVYTYKVTQSDLQGHECWDYVSVWSCWGRCDSSEISDWKF-PYKRSFHPVCVHAQRQLVVAILK 110
            ||...|.:|            ::...|.|.|.:.:|:...| |.......||.:.........:.
  Rat    33 RRECAYCLT------------INTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFTYRTVEIP 85

  Fly   111 NC-HPKAEDSVSKYQYMEAVNCHCQTCSTQDTSC--EAPANN 149
            .| |..|    ..:.|..|::|.|..|:|..:.|  ||...|
  Rat    86 GCPHHVA----PYFSYPVALSCKCGKCNTDYSDCTHEAVKTN 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 22/100 (22%)
TshbNP_037248.2 GHB 19..126 CDD:214502 25/107 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338114
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362225at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11515
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.