DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and FSHB

DIOPT Version :9

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_000501.1 Gene:FSHB / 2488 HGNCID:3964 Length:129 Species:Homo sapiens


Alignment Length:87 Identity:21/87 - (24%)
Similarity:35/87 - (40%) Gaps:6/87 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LQGHECWDYVSVWSCW--GRCDSSEISDWKFPYKRSFHPVCVHAQRQLVVAILKNCHPKAEDSVS 121
            ::..||...:|:.:.|  |.|.:.::. :|.|.:......|...:.......:..|   |..:.|
Human    30 IEKEECRFCISINTTWCAGYCYTRDLV-YKDPARPKIQKTCTFKELVYETVRVPGC---AHHADS 90

  Fly   122 KYQYMEAVNCHCQTCSTQDTSC 143
            .|.|..|..|||..|.:..|.|
Human    91 LYTYPVATQCHCGKCDSDSTDC 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 21/87 (24%)
FSHBNP_000501.1 GHB 17..123 CDD:214502 21/87 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144397
Domainoid 1 1.000 57 1.000 Domainoid score I10884
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362225at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11515
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.