DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and T23B12.8

DIOPT Version :9

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001367962.1 Gene:T23B12.8 / 188778 WormBaseID:WBGene00020722 Length:125 Species:Caenorhabditis elegans


Alignment Length:134 Identity:33/134 - (24%)
Similarity:47/134 - (35%) Gaps:23/134 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IIFFRTLAIFVGTSVVLVSVSSSSLSE----IKPMNNGHIVTPLGCHRRVYTYKVTQSDLQGHEC 64
            ::.|..:.|.   .:.|:||.|....|    :.|..|     ||           .|.|..|.||
 Worm     1 MLIFPVITIL---HIFLISVESGKECEFAMRLVPGFN-----PL-----------RQVDANGKEC 46

  Fly    65 WDYVSVWSCWGRCDSSEISDWKFPYKRSFHPVCVHAQRQLVVAILKNCHPKAEDSVSKYQYMEAV 129
            ...|.:..|.|.|.:||.....||.:.....||..........:|.:|...|::||.........
 Worm    47 RGNVELPFCKGYCKTSESGTHGFPPRVQNSKVCTLVTTSTRKVVLDDCDDGADESVKFVMVPHGT 111

  Fly   130 NCHC 133
            :|.|
 Worm   112 DCEC 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 22/89 (25%)
T23B12.8NP_001367962.1 GHB_like <55..117 CDD:419725 16/61 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362225at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109629
Panther 1 1.100 - - LDO PTHR11515
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.