DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and Lhb

DIOPT Version :9

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_030098037.1 Gene:Lhb / 16866 MGIID:96782 Length:405 Species:Mus musculus


Alignment Length:147 Identity:31/147 - (21%)
Similarity:45/147 - (30%) Gaps:35/147 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VLVSVSSSSLSEIKPMNNGHIVTP---------LGCHRRVYTYKVTQSDLQGHECWDYVS----- 69
            |||..|.|....|..:.:|.::.|         ||...:|.|.......|:....|..:|     
Mouse    54 VLVGGSPSPPHAIGWVQSGQVLLPGATVTTSRFLGFPEKVRTMAGRTLALRYGPPWSPISETEVL 118

  Fly    70 -VWSCWGRCDSSEISDW----KFPYKRSFHPVCVHAQRQLVVAILKNCHPKAEDSVSKYQYMEAV 129
             .|..|....|.....|    .||         :...:.:|.|.|    |.....:|::   |..
Mouse   119 GTWPNWHLTSSGVAHHWIPPASFP---------LPTLQSMVKAPL----PAVSKVISRW---ETT 167

  Fly   130 NCHCQTCSTQDTSCEAP 146
            :....|..|....|..|
Mouse   168 SQSTYTPKTHGGPCAQP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 19/108 (18%)
LhbXP_030098037.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834534
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11515
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.