DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and GPHB5

DIOPT Version :9

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_660154.3 Gene:GPHB5 / 122876 HGNCID:18055 Length:130 Species:Homo sapiens


Alignment Length:133 Identity:37/133 - (27%)
Similarity:63/133 - (47%) Gaps:10/133 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IFVGTSVVLVSVSSSSLSEIKPMNNGHIVTPLGCHRRVYTYKVTQSDLQGHECWDYVSVWSCWGR 76
            :|:|...:|:......   :...::|::.|.:||..|.:|:...:...:|..    ::..:||||
Human     6 LFLGPMALLLLAGYGC---VLGASSGNLRTFVGCAVREFTFLAKKPGCRGLR----ITTDACWGR 63

  Fly    77 CDSSEISDWKFPYKRSFHPVCVHAQRQLVVAILKNCHPKAEDSVSKYQYMEAVNCHCQTCSTQDT 141
            |::.|....:.||..:.|.||.:.:.:.|...|.||.|..:..   |.|..|:.|.|..|||..|
Human    64 CETWEKPILEPPYIEAHHRVCTYNETKQVTVKLPNCAPGVDPF---YTYPVAIRCDCGACSTATT 125

  Fly   142 SCE 144
            .||
Human   126 ECE 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 29/98 (30%)
GPHB5NP_660154.3 GHB_like 36..129 CDD:200450 31/100 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144395
Domainoid 1 1.000 57 1.000 Domainoid score I10884
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5373
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362225at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto89878
orthoMCL 1 0.900 - - OOG6_109629
Panther 1 1.100 - - O PTHR11515
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5224
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.