DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and CGB3

DIOPT Version :10

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_000728.1 Gene:CGB3 / 1082 HGNCID:1886 Length:165 Species:Homo sapiens


Alignment Length:85 Identity:15/85 - (17%)
Similarity:26/85 - (30%) Gaps:28/85 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PVCVHAQRQL-------VVAILKNCHPKAEDSVSKYQ---------------------YMEAVNC 131
            |||:.....:       :..:|:...|.....|..|:                     |..|::|
Human    44 PVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSC 108

  Fly   132 HCQTCSTQDTSCEAPANNEM 151
            .|..|....|.|..|.::.:
Human   109 QCALCRRSTTDCGGPKDHPL 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 13/76 (17%)
CGB3NP_000728.1 GHB 25..131 CDD:214502 15/85 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..165
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.