DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and fshb

DIOPT Version :9

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_017948784.1 Gene:fshb / 100495812 XenbaseID:XB-GENE-484695 Length:134 Species:Xenopus tropicalis


Alignment Length:83 Identity:26/83 - (31%)
Similarity:32/83 - (38%) Gaps:11/83 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CWDYVSVWSCWGRC---DSSEISDWKFPYKRSFHPVCVHAQRQLVVAILKNCHPKAEDSVSKYQY 125
            |....:.| |.|.|   |||.    |.|..|....||.:.........|..|   ||:....|.|
 Frog    38 CITVNATW-CSGYCLTRDSSS----KHPLIRKVQHVCTYTDIIYETVRLPGC---AENIDPYYSY 94

  Fly   126 MEAVNCHCQTCSTQDTSC 143
            ..|::|||..|:...|.|
 Frog    95 PVAIDCHCDLCNIHTTDC 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 26/83 (31%)
fshbXP_017948784.1 GHB 18..123 CDD:214502 26/83 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10675
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5203
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362225at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.