DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and gphb5

DIOPT Version :9

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001159810.1 Gene:gphb5 / 100310830 ZFINID:ZDB-GENE-090319-4 Length:134 Species:Danio rerio


Alignment Length:101 Identity:26/101 - (25%)
Similarity:46/101 - (45%) Gaps:7/101 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LGCHRRVYTYKVTQSDLQGHECWDYVSVWSCWGRCDSSEISDWKFPYKRSFHPVCVHAQRQLVVA 107
            :||..|.:|:...:....|.    :::..:|||||::.:....:.|:..|...||.:.:.:....
Zfish    37 IGCAVREFTFLARKPGCGGL----HITTDACWGRCETWQKPVLEPPFIESHQRVCTYNETRQETV 97

  Fly   108 ILKNCHPKAEDSVSKYQYMEAVNCHCQTCSTQDTSC 143
            :|.||....:.|   |.:..|:.|.|..|.|..|.|
Zfish    98 LLPNCTAGVDPS---YSFPVALRCDCGLCLTSTTEC 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 25/99 (25%)
gphb5NP_001159810.1 GHB_like 39..132 CDD:200450 25/99 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577505
Domainoid 1 1.000 46 1.000 Domainoid score I12097
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5467
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362225at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109629
Panther 1 1.100 - - O PTHR11515
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5224
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.