DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and LOC100001596

DIOPT Version :9

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_017209108.2 Gene:LOC100001596 / 100001596 -ID:- Length:192 Species:Danio rerio


Alignment Length:106 Identity:30/106 - (28%)
Similarity:45/106 - (42%) Gaps:15/106 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LGCHRRVYTYKVTQSDLQGHECWDYVSVWS--CWGRCDSSEISDWKFPYKR-SFHPVCVHAQRQL 104
            |.|..:.||..|     :.|||...:::.:  |.|.|.:.:.:...|..|| .....|:|  |.|
Zfish    79 LACSLKNYTLYV-----EKHECGHCMAINTTVCSGMCFTRDTNVQGFVGKRFLLQQSCMH--RSL 136

  Fly   105 VV--AILKNCHPKAEDSVSKYQYMEAVNCHCQTCSTQDTSC 143
            |.  |.:..| |...|.:  :.|..|..|:|..|:|....|
Zfish   137 VYRSARMPGC-PVHIDPL--FFYPVARRCNCTKCNTSRNEC 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 29/104 (28%)
LOC100001596XP_017209108.2 GHB_like 81..177 CDD:200450 29/104 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I12097
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362225at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11515
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.