DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim23 and TIMM23B

DIOPT Version :10

Sequence 1:NP_001015387.1 Gene:Tim23 / 3355096 FlyBaseID:FBgn0267976 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001277046.1 Gene:TIMM23B / 100652748 HGNCID:23581 Length:188 Species:Homo sapiens


Alignment Length:56 Identity:14/56 - (25%)
Similarity:26/56 - (46%) Gaps:4/56 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VKLGNFYDNFKVDVVSLTKTDMEFDMIGIDAAFANAFRRILIAEV---PSMAIEKV 117
            |..|.|:|. .:..:.|.:..:.|..:.:......|:.|..:|:|   |.:.:|||
Human   321 VSHGQFFDQ-HLKFIKLNQQFVPFTQLDLSYLQQEAYDRDFLAQVYGAPQLQVEKV 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim23NP_001015387.1 TIM22 42..188 CDD:470560 14/56 (25%)
TIMM23BNP_001277046.1 TIM22 46..171 CDD:470560
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.