DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and nudF

DIOPT Version :10

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_417506.1 Gene:nudF / 947519 ECOCYCID:EG12633 Length:209 Species:Escherichia coli


Alignment Length:49 Identity:16/49 - (32%)
Similarity:25/49 - (51%) Gaps:4/49 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 NTKETWPGKW-DNMVGGGLSVGFGIKETAIKEAAEEASIPSDLVKNLVS 208
            :|.||   .| ..||.|.:..|..:::.|.:||.|||.:.....|.::|
E. coli    84 DTSET---PWLLEMVAGMIEEGESVEDVARREAIEEAGLIVKRTKPVLS 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:406365
NUDIX_Tnr3_like 131..282 CDD:467544 16/49 (33%)
nudFNP_417506.1 nudF 9..209 CDD:182682 16/49 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.