DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and nudK

DIOPT Version :10

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_416962.1 Gene:nudK / 947072 ECOCYCID:EG12410 Length:191 Species:Escherichia coli


Alignment Length:42 Identity:15/42 - (35%)
Similarity:20/42 - (47%) Gaps:10/42 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GLIKSDVLKHLEKYPEVFCIR--ACEQTKQGLVELNPAFRDY 81
            ||:.:|       .||| |||  |.|:|...:.|:...|..|
E. coli    86 GLLDND-------EPEV-CIRKEAIEETGYEVGEVRKLFELY 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:406365 15/42 (36%)
NUDIX_Tnr3_like 131..282 CDD:467544
nudKNP_416962.1 PRK15009 1..191 CDD:184971 15/42 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.