DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and THI80

DIOPT Version :9

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_014786.1 Gene:THI80 / 854314 SGDID:S000005669 Length:319 Species:Saccharomyces cerevisiae


Alignment Length:181 Identity:39/181 - (21%)
Similarity:66/181 - (36%) Gaps:54/181 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KSDVLKHLEKYPEVF--CIRACEQTKQGLVEL---NPAFRDYNERTE--------QLEK---VLR 93
            |..::|...:|...|  |:        .|:.|   :|.||......:        :|||   .|.
Yeast   113 KVTIIKQTTQYSTDFTKCV--------NLISLHFNSPEFRSLISNKDNLQSNHGIELEKGIHTLY 169

  Fly    94 NLRSEGL---------FPALQGWRDEYFEVKADCRALLKMERAA--------TP---LFGVRKYG 138
            |..:|.|         ..||.|....:.:.......|..:...|        ||   :|.::|.|
Yeast   170 NTMTESLVFSKVTPISLLALGGIGGRFDQTVHSITQLYTLSENASYFKLCYMTPTDLIFLIKKNG 234

  Fly   139 --VDINGYVRHPTLGLC--IWLQQRSNTKETWPGKWD------NMVGGGLS 179
              ::.:...|:..:|.|  :.:.:.:..|||...|||      ::|.|.:|
Yeast   235 TLIEYDPQFRNTCIGNCGLLPIGEATLVKETRGLKWDVKNWPTSVVTGRVS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:292538 25/126 (20%)
Nudix_hydrolase_3 106..283 CDD:239648 20/95 (21%)
THI80NP_014786.1 ThiN 38..314 CDD:224480 39/181 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1532
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.