DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and YSA1

DIOPT Version :9

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_009669.1 Gene:YSA1 / 852408 SGDID:S000000315 Length:231 Species:Saccharomyces cerevisiae


Alignment Length:189 Identity:39/189 - (20%)
Similarity:62/189 - (32%) Gaps:64/189 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 FRDYNERTEQLEKVLRNLRSE------GLFPALQGWRDEYFEVKADCRALLKMERAATPLFGVRK 136
            ::|.|.:..:.:..:|..||.      |:...|     :|.:.|.| ..||:.:           
Yeast    54 YKDPNGKEREWDSAVRTTRSSGGVDGIGILTIL-----KYKDGKPD-EILLQKQ----------- 101

  Fly   137 YGVDINGYVRHPTLGLCIWLQQRSNTKETWPGKWDNMVGGGLSVGFGIKETAIKEAAEEASIPSD 201
                    .|.|..|:||                 .|..|.:..|..|...|::|..||..... 
Yeast   102 --------FRPPVEGVCI-----------------EMPAGLIDAGEDIDTAALRELKEETGYSG- 140

  Fly   202 LVKNLVSAGCVSFYFESRQGLFPNTEYVF-----DLELPLDFVP--QNADGE-VQAFEL 252
               .::|.....|   :..| |.||....     |:.||.:..|  |..|.| ::.|.:
Yeast   141 ---KIISKSPTVF---NDPG-FTNTNLCLVTVEVDMSLPENQKPVTQLEDNEFIECFSV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:292538 12/63 (19%)
Nudix_hydrolase_3 106..283 CDD:239648 32/155 (21%)
YSA1NP_009669.1 ADPRase_NUDT5 76..213 CDD:239516 34/167 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.