DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and PCD1

DIOPT Version :9

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_013252.1 Gene:PCD1 / 850844 SGDID:S000004141 Length:340 Species:Saccharomyces cerevisiae


Alignment Length:252 Identity:54/252 - (21%)
Similarity:84/252 - (33%) Gaps:75/252 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 LCIWLQQRSNTKETWPGKWDNMVGGGLSVGFGIKET----AIKEAAEEASIPSD----------L 202
            |.:.|.:||.|..::.|  |....||.:..|  :||    |.:||.||..:|.|          .
Yeast    54 LRVLLTKRSRTLRSFSG--DVSFPGGKADYF--QETFESVARREAEEEIGLPHDPEVLHKEFGMK 114

  Fly   203 VKNLV-SAGC------------VSFYFESRQGLFPNTEYVFDLELPLD---FVPQNADGEVQAFE 251
            :.||| ...|            |.|.::.:.     .::....::|||   |..:...||..:..
Yeast   115 LDNLVMDMPCYLSRTFLSVKPMVCFLYKDKL-----EKHEDKYKVPLDIRKFFGKLNPGETSSLF 174

  Fly   252 LLTAKDCVERVF---TSDFKTTSAPVV-----------IDFLIRHGHITADDVVDFTQIVELLHV 302
            .:...|.|..:.   ..|.|:..|...           |.:||.|.|.         .:.....:
Yeast   175 SVPLNDLVIHLLPEADEDVKSYQAEYFERKEYKLNWGGIKWLIMHYHF---------HVANNNEM 230

  Fly   303 P-LQSIYTYKTRFEQSIKQPQFLPGDSKNCNCAIF------------QKISMENGHK 346
            | ||:|....:..|..:....|...|.....|.|.            :|:..|.||:
Yeast   231 PWLQTIEDLSSSDEDGVDGGIFRFRDLWGLTCKILFDVSCIANGLMDEKLKGELGHE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:292538
Nudix_hydrolase_3 106..283 CDD:239648 39/174 (22%)
PCD1NP_013252.1 CoAse 38..265 CDD:239518 49/228 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.