DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and NUDT21

DIOPT Version :10

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_177495.2 Gene:NUDT21 / 843688 AraportID:AT1G73540 Length:198 Species:Arabidopsis thaliana


Alignment Length:98 Identity:21/98 - (21%)
Similarity:42/98 - (42%) Gaps:17/98 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 GKWDNMVGGGLSVGFGIKETAIKEAAEEASIPSDLVKNLVSAGCVSFYFESRQGLFPNTEYVFDL 232
            ||...:..||..:...|:|.|::|..|||.:...|.::|     ..:.::|::....:..::|.|
plant    90 GKGMLLPKGGWEIDESIEEAALRETIEEAGVTGQLEESL-----GKWQYKSKRHTMIHDGHMFPL 149

  Fly   233 ELPLDFVPQNADGEVQAFELLTAKDCVERVFTS 265
            .:.            |.||:....:..:|.:.|
plant   150 LVS------------QQFEIWPESEFRQRKWVS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:406365
NUDIX_Tnr3_like 131..282 CDD:467544 21/98 (21%)
NUDT21NP_177495.2 NUDIX_DIPP2_like_Nudt4 62..190 CDD:467551 21/98 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.