powered by:
Protein Alignment CG12567 and nudt19
DIOPT Version :9
Sequence 1: | NP_001015384.1 |
Gene: | CG12567 / 3355094 |
FlyBaseID: | FBgn0039958 |
Length: | 349 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001122258.1 |
Gene: | nudt19 / 794545 |
ZFINID: | ZDB-GENE-081022-80 |
Length: | 397 |
Species: | Danio rerio |
Alignment Length: | 49 |
Identity: | 15/49 - (30%) |
Similarity: | 17/49 - (34%) |
Gaps: | 16/49 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 CEQ-------TKQGLVELNPAFRDYNERTE---------QLEKVLRNLR 96
||| |..|.|.|.|....|.|..: :.||.|..||
Zfish 301 CEQWLPVHMLTSDGFVSLLPGDTMYQENVDSSGNGGGVLKTEKSLEELR 349
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG12567 | NP_001015384.1 |
DUF4743 |
11..136 |
CDD:292538 |
15/49 (31%) |
Nudix_hydrolase_3 |
106..283 |
CDD:239648 |
|
nudt19 | NP_001122258.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0494 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.