DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and Nudt11

DIOPT Version :10

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001388133.1 Gene:Nudt11 / 680248 RGDID:1594183 Length:164 Species:Rattus norvegicus


Alignment Length:67 Identity:20/67 - (29%)
Similarity:28/67 - (41%) Gaps:9/67 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 WPGKWDNMVGGGLSVGFGIKETAIKEAAEEASIPSDLVKNLVSAGCVSFYFESRQGLFPNTEYVF 230
            :|.:| .:.|||:.........|::|..|||.:...|       |.:...||..|.....| |||
  Rat    41 YPDRW-IVPGGGMEPEEEPDGAAVREVYEEAGVKGKL-------GRLLGVFEQNQDRKHRT-YVF 96

  Fly   231 DL 232
            .|
  Rat    97 VL 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:406365
NUDIX_Tnr3_like 131..282 CDD:467544 20/67 (30%)
Nudt11NP_001388133.1 NUDIX_DIPP2_like_Nudt4 18..143 CDD:467551 20/67 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.