powered by:
Protein Alignment CG12567 and Nudt11
DIOPT Version :9
Sequence 1: | NP_001015384.1 |
Gene: | CG12567 / 3355094 |
FlyBaseID: | FBgn0039958 |
Length: | 349 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_003752064.1 |
Gene: | Nudt11 / 680248 |
RGDID: | 1594183 |
Length: | 164 |
Species: | Rattus norvegicus |
Alignment Length: | 67 |
Identity: | 20/67 - (29%) |
Similarity: | 28/67 - (41%) |
Gaps: | 9/67 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 166 WPGKWDNMVGGGLSVGFGIKETAIKEAAEEASIPSDLVKNLVSAGCVSFYFESRQGLFPNTEYVF 230
:|.:| .:.|||:.........|::|..|||.:...| |.:...||..|.....| |||
Rat 41 YPDRW-IVPGGGMEPEEEPDGAAVREVYEEAGVKGKL-------GRLLGVFEQNQDRKHRT-YVF 96
Fly 231 DL 232
.|
Rat 97 VL 98
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0494 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.