DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and CG14721

DIOPT Version :9

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_650110.3 Gene:CG14721 / 41417 FlyBaseID:FBgn0037942 Length:345 Species:Drosophila melanogaster


Alignment Length:158 Identity:39/158 - (24%)
Similarity:61/158 - (38%) Gaps:44/158 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 KEAAEEASIP--SDLVKNLVSAGCVSFYFESRQGLFPNTEYVFDLELPLDFVPQNADGEVQAFEL 252
            |.||...::.  |:..::.|.|..:|   :...|..|.|    .|| |||.:..:       |:.
  Fly   120 KNAAVRCAVDGGSNHWRDFVVAQAMS---KKANGSAPTT----PLE-PLDVITGD-------FDS 169

  Fly   253 LTAKDCVERVFTSD-FKTTSAPVVIDFLIRHGHITADDVVDFTQIVELLHV-----PLQSIYTY- 310
            :|.:       |.| ||||  |.|        |....|..|||:.:.:|..     .:|.:..: 
  Fly   170 ITEE-------TVDFFKTT--PKV--------HTPDQDATDFTKAMAVLQPVMTQRKIQDVVVFH 217

  Fly   311 --KTRFEQSIKQPQFLPGDSKNCNCAIF 336
              ..|.:|.:.....|....|: ||.:|
  Fly   218 DTSGRLDQVMANLNTLYKSQKD-NCNVF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:292538
Nudix_hydrolase_3 106..283 CDD:239648 25/95 (26%)
CG14721NP_650110.3 TPK 100..328 CDD:153431 39/158 (25%)
thi_PPkinase 101..330 CDD:273588 39/158 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448852
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13622
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1532
SonicParanoid 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.