DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and CG14721

DIOPT Version :10

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_650110.3 Gene:CG14721 / 41417 FlyBaseID:FBgn0037942 Length:345 Species:Drosophila melanogaster


Alignment Length:158 Identity:39/158 - (24%)
Similarity:61/158 - (38%) Gaps:44/158 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 KEAAEEASIP--SDLVKNLVSAGCVSFYFESRQGLFPNTEYVFDLELPLDFVPQNADGEVQAFEL 252
            |.||...::.  |:..::.|.|..:|   :...|..|.|    .|| |||.:..:       |:.
  Fly   120 KNAAVRCAVDGGSNHWRDFVVAQAMS---KKANGSAPTT----PLE-PLDVITGD-------FDS 169

  Fly   253 LTAKDCVERVFTSD-FKTTSAPVVIDFLIRHGHITADDVVDFTQIVELLHV-----PLQSIYTY- 310
            :|.:       |.| ||||  |.|        |....|..|||:.:.:|..     .:|.:..: 
  Fly   170 ITEE-------TVDFFKTT--PKV--------HTPDQDATDFTKAMAVLQPVMTQRKIQDVVVFH 217

  Fly   311 --KTRFEQSIKQPQFLPGDSKNCNCAIF 336
              ..|.:|.:.....|....|: ||.:|
  Fly   218 DTSGRLDQVMANLNTLYKSQKD-NCNVF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:406365
NUDIX_Tnr3_like 131..282 CDD:467544 25/94 (27%)
CG14721NP_650110.3 thi_PPkinase 101..330 CDD:273588 39/158 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.