DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and CG11095

DIOPT Version :9

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_572927.1 Gene:CG11095 / 32348 FlyBaseID:FBgn0030528 Length:283 Species:Drosophila melanogaster


Alignment Length:152 Identity:36/152 - (23%)
Similarity:55/152 - (36%) Gaps:40/152 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EKYPEVFCIRACEQTKQGLVELNPAFRDYNERTEQLEKVLRNLRSEGL---FPALQGWRDEYFEV 114
            ||......|..|::            |..||.:....:..|:|||...   ||.  |.||::...
  Fly    80 EKQTSAVLIALCQE------------RGTNEISLLYTRRSRHLRSHSFQISFPG--GRRDDHDSS 130

  Fly   115 KADCRALLKMERAATPLFGVRKYGVDINGYVRHPTLGLCIWLQQRSNTKETWPGKWDNMVGGGLS 179
            ..|| ||.:.|..    .|:.::.:.:.|..:.         .|...|....|     :|  |:.
  Fly   131 YVDC-ALRETEEE----IGLPRHRIQVWGEAKQ---------LQLPRTSSIVP-----VV--GVV 174

  Fly   180 VGFGIKETAIK-EAAEEA-SIP 199
            ..|.:.|..:. |..||| |:|
  Fly   175 PDFSLSELRLNWEEVEEAFSVP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:292538 22/85 (26%)
Nudix_hydrolase_3 106..283 CDD:239648 23/96 (24%)
CG11095NP_572927.1 CoAse 84..238 CDD:239518 34/148 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.