DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and Nudt14

DIOPT Version :10

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001100230.1 Gene:Nudt14 / 299346 RGDID:1310583 Length:222 Species:Rattus norvegicus


Alignment Length:119 Identity:32/119 - (26%)
Similarity:45/119 - (37%) Gaps:37/119 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 QRSNTKETWPGKWDNMVGGGLSVG------FGIKETAIKEAAEEAS---IPSDLVKNLVSAGCVS 213
            |....::..||....||  .|..|      ..::|.|.|||.||..   :|:||.:       |:
  Rat    85 QPQELQQILPGSAGVMV--ELCAGIVDQPELSLEEVACKEAWEECGYHLVPADLRR-------VA 140

  Fly   214 FYFE------SRQGLF-----------PNTEYVFDLELPLDFVPQNADGEVQAF 250
            .|..      |||.:|           |......:.|| ::.|..|.| :.|||
  Rat   141 TYMSGVGLTGSRQTMFYAEVTDAQRGGPGGGLAEEGEL-IEVVHLNVD-DAQAF 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:406365
NUDIX_Tnr3_like 131..282 CDD:467544 32/119 (27%)
Nudt14NP_001100230.1 NUDIX_UGPPase_Nudt14 25..212 CDD:467597 32/119 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.