DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and Tpk1

DIOPT Version :9

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_038889.1 Gene:Tpk1 / 29807 MGIID:1352500 Length:243 Species:Mus musculus


Alignment Length:132 Identity:29/132 - (21%)
Similarity:52/132 - (39%) Gaps:18/132 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 TKQGLVELNPAFRDYNERTEQLEKVLRNLRSEGL----FPALQGWRDEYFEVKADCRALLKMER- 126
            ||:|...::...:|:.:.|:.|:.:.|.:..:.|    ...|.|....:.::.|....|.:... 
Mouse    84 TKKGCDLISTPDQDHTDFTKCLQVLQRKIEEKELQVDVIVTLGGLGGRFDQIMASVNTLFQATHI 148

  Fly   127 AATPLFGVRK----YGVDINGYVRHPTLGL----C--IWLQQRSNTKETWPGKWDNMVGGGLSVG 181
            ...|:..::|    |.:....:..|...|:    |  |.:.|..|...|...|| |:....|  |
Mouse   149 TPVPIIIIQKDSLIYLLQPGKHRLHVDTGMEGSWCGLIPVGQPCNQVTTTGLKW-NLTNDVL--G 210

  Fly   182 FG 183
            ||
Mouse   211 FG 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:292538 13/73 (18%)
Nudix_hydrolase_3 106..283 CDD:239648 20/89 (22%)
Tpk1NP_038889.1 TPK 20..239 CDD:153431 29/132 (22%)
PLN02714 21..241 CDD:178316 29/132 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1532
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.