DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and Nudt2

DIOPT Version :9

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_997479.1 Gene:Nudt2 / 297998 RGDID:1303023 Length:147 Species:Rattus norvegicus


Alignment Length:147 Identity:30/147 - (20%)
Similarity:46/147 - (31%) Gaps:53/147 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 LQQRSNTKETW-PGKWDNMVGGGLSVGFGIKETAIKEAAEEASIPSDLVKNLVSAGCVSFYFESR 219
            |.|.|:....| |.|      |.:..|....|||::|..||..|.:..:..|             
  Rat    28 LLQASDGIHHWTPPK------GHVDPGENDLETALRETQEETGIEASQLIVL------------- 73

  Fly   220 QGLFPNTEYV-----------------FDLELPLDFVPQNADGEVQAFELLTAKDCVERVFTSDF 267
            :|......||                 :|:|:.|       ..|.||:..|...:..:.....:.
  Rat    74 EGFRRELNYVARKKPKTVIYWLAEVKDYDVEIRL-------SQEHQAYRWLGLDEACQLAQFEEM 131

  Fly   268 KTTSAPVVIDFLIRHGH 284
            |.|         ::.||
  Rat   132 KAT---------LQEGH 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:292538
Nudix_hydrolase_3 106..283 CDD:239648 28/144 (19%)
Nudt2NP_997479.1 Ap4A_hydrolase_human_like 2..140 CDD:239520 30/147 (20%)
Nudix box 43..64 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.