DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and NUDT7

DIOPT Version :10

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001099133.1 Gene:NUDT7 / 283927 HGNCID:8054 Length:238 Species:Homo sapiens


Alignment Length:142 Identity:35/142 - (24%)
Similarity:53/142 - (37%) Gaps:44/142 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSRLLILAQKFNNFYLSGIHKCDIRPFVVEGKQVGLIKSDVLKHL--EKYPEVFCIRACEQTKQG 70
            :|||.:..:...|..|... |..:|.:.:.||         ..||  .||..:..:.|    |:|
Human     1 MSRLGLPEEPVRNSLLDDA-KARLRKYDIGGK---------YSHLPYNKYSVLLPLVA----KEG 51

  Fly    71 LVELNPAFRDYNERTEQLEKVLRNLRSEGLFPALQGWRDEYFEVKADCRALLKMERAATPL---- 131
            .:.|.     :..|:|:    ||....|..||.  |.||.           ..|:.|||.|    
Human    52 KLHLL-----FTVRSEK----LRRAPGEVCFPG--GKRDP-----------TDMDDAATALREAQ 94

  Fly   132 --FGVRKYGVDI 141
              .|:|.:.|::
Human    95 EEVGLRPHQVEV 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:406365 31/132 (23%)
NUDIX_Tnr3_like 131..282 CDD:467544 4/17 (24%)
NUDT7NP_001099133.1 NUDIX_CoAse_Nudt7 38..195 CDD:467532 24/95 (25%)
Nudix box 77..98 7/31 (23%)
Microbody targeting signal. /evidence=ECO:0000250 236..238
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.