DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and NUDT8

DIOPT Version :10

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001230679.1 Gene:NUDT8 / 254552 HGNCID:8055 Length:236 Species:Homo sapiens


Alignment Length:149 Identity:39/149 - (26%)
Similarity:51/149 - (34%) Gaps:48/149 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 CRALLKMERA-----------ATPLFGVRKYGVDINGYVRHPTLGLCIWLQQRSNTKETWPGKWD 171
            ||.||....|           ..||..||  ||        |.|     |....:::.|...|.|
Human    14 CRRLLAGATARLRARPASAAVLVPLCSVR--GV--------PAL-----LYTLRSSRLTGRHKGD 63

  Fly   172 NMVGGGL--SVGFGIKETAIKEAAEE--ASIPSDLVKNL--------------VSAGCVSFYFES 218
            ....||.  .....:..||::|..||  .::|.:.|..|              |.||....   .
Human    64 VSFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATVVPVLAGVGPL---D 125

  Fly   219 RQGLFPNTEYVFDL-ELPL 236
            .|.|.||:|.|.:: .|||
Human   126 PQSLRPNSEEVDEVFALPL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:406365 8/28 (29%)
NUDIX_Tnr3_like 131..282 CDD:467544 33/125 (26%)
NUDT8NP_001230679.1 NUDIX_CoAse_Nudt7 32..186 CDD:467532 34/131 (26%)
Nudix box 70..91 5/20 (25%)

Return to query results.
Submit another query.