Sequence 1: | NP_001015384.1 | Gene: | CG12567 / 3355094 | FlyBaseID: | FBgn0039958 | Length: | 349 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_503726.1 | Gene: | ndx-2 / 189126 | WormBaseID: | WBGene00003579 | Length: | 223 | Species: | Caenorhabditis elegans |
Alignment Length: | 197 | Identity: | 41/197 - (20%) |
---|---|---|---|
Similarity: | 66/197 - (33%) | Gaps: | 60/197 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 158 QRSNTKETWPGKW--DNMVGGGLSVGFGIKETAIKEAAEEASIPSDLVKNLVSAGCVSFYFESR- 219
Fly 220 QGLFPNTEYV------------FDLELPLDFVP-------------QNADGEVQAFELLTAKDC- 258
Fly 259 VERVFTSDFKTTSAPVVIDFLIRHGHITAD--------DVVDFTQIVELLHVPLQSIYTYKTRFE 315
Fly 316 QS 317 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12567 | NP_001015384.1 | DUF4743 | 11..136 | CDD:292538 | |
Nudix_hydrolase_3 | 106..283 | CDD:239648 | 31/153 (20%) | ||
ndx-2 | NP_503726.1 | ADPRase_NUDT5 | 75..221 | CDD:239516 | 29/143 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0494 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |