DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and ndx-7

DIOPT Version :10

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_491336.2 Gene:ndx-7 / 183413 WormBaseID:WBGene00003584 Length:295 Species:Caenorhabditis elegans


Alignment Length:168 Identity:29/168 - (17%)
Similarity:51/168 - (30%) Gaps:68/168 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IRACEQTKQ---------------------GLVE-----LNPAFRDYNERTEQLEKVLRNLRSEG 99
            |.||:.|::                     |:|:     |...||        :..|.......|
 Worm    17 ILACKTTRRVLMLKRGTTAKFMPNTMVFPGGVVDKTDAKLGDEFR--------IAAVRELFEESG 73

  Fly   100 LFPALQGWR-----DEYFEVKAD---------------CR-ALLKMERAATPLFGVRKYGVDING 143
            :.....||:     .:...:|||               |. .|::.:...||....|::....  
 Worm    74 VLSTKNGWQTSANNPDMTSLKADIVNDTSKFEQLSGTICADNLIEWDTFITPANYPRRFLTKF-- 136

  Fly   144 YVR----HPTLGLCI-------WLQQRSNTKETWPGKW 170
            |:.    .|.:.||.       |::.:....|.:.||:
 Worm   137 YLMLVDDEPAIDLCTSEMSEYNWIEPKECVDEAYAGKY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:406365 20/121 (17%)
NUDIX_Tnr3_like 131..282 CDD:467544 9/51 (18%)
ndx-7NP_491336.2 NUDIX_AcylCoAdiphos_Nudt19 13..187 CDD:467582 29/168 (17%)

Return to query results.
Submit another query.