DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and Nudt1

DIOPT Version :9

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001343512.1 Gene:Nudt1 / 17766 MGIID:109280 Length:156 Species:Mus musculus


Alignment Length:133 Identity:32/133 - (24%)
Similarity:50/133 - (37%) Gaps:30/133 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 GKWDNMVGGGLSVGFGIKETAIKEAAEEASIPSDLVKNLVSAGCVSFYFESRQGLFPNTEYVFDL 232
            |:| |..||.:..|..|::.|.:|..||:.:..|   .|...|.:||.|.....|.  ..::|..
Mouse    30 GRW-NGFGGKVQEGETIEDGAKRELLEESGLSVD---TLHKVGHISFEFVGSPELM--DVHIFSA 88

  Fly   233 E----------------LPLDFVPQNAD---GEVQAFELLTAKDCVERVFTSDFKTTSAPVVIDF 278
            :                ..||.:| .||   .:...|.||..|    :.|...||......::.:
Mouse    89 DHVHGTPTESEEMRPQWFQLDQIP-FADLWPDDSYWFPLLLQK----KKFCGHFKFQDQDTILSY 148

  Fly   279 LIR 281
            .:|
Mouse   149 SLR 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:292538
Nudix_hydrolase_3 106..283 CDD:239648 32/133 (24%)
Nudt1NP_001343512.1 MTH1 6..140 CDD:239519 31/120 (26%)
Substrate binding. /evidence=ECO:0000269|PubMed:29281266, ECO:0007744|PDB:5MZE 35..38 1/2 (50%)
Nudix box. /evidence=ECO:0000255|PROSITE-ProRule:PRU00794 37..58 7/20 (35%)
Substrate binding. /evidence=ECO:0000269|PubMed:29281266, ECO:0007744|PDB:5MZE 117..120 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.