DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12567 and NUDT10

DIOPT Version :9

Sequence 1:	NP_001015384.1	Gene:	CG12567 / 3355094	FlyBaseID:	FBgn0039958	Length:	349	Species:	Drosophila melanogaster
Sequence 2:	NP_001291892.1	Gene:	NUDT10 / 170685	HGNCID:	17621	Length:	164	Species:	Homo sapiens

Alignment Length:	67	Identity:	19/67 - (28%)
Similarity:	28/67 - (41%)	Gaps:	9/67 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   166 WPGKWDNMVGGGLSVGFGIKETAIKEAAEEASIPSDLVKNLVSAGCVSFYFESRQGLFPNTEYVF 230
            :|.:| .:.|||:.........|::|..|||.:...|       |.:...||..|.....| ||:
Human    41 YPDRW-IVPGGGMEPEEEPGGAAVREVYEEAGVKGKL-------GRLLGVFEQNQDPKHRT-YVY 96

  Fly   231 DL 232
            .|
Human    97 VL 98

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12567	NP_001015384.1	DUF4743	11..136	CDD:292538
CG12567	NP_001015384.1	Nudix_hydrolase_3	106..283	CDD:239648	19/67 (28%)
NUDT10	NP_001291892.1	Substrate binding. /evidence=ECO:0000250\|UniProtKB:O95989	17..19
		Nudix_Hydrolase_9	18..137	CDD:240024	19/67 (28%)
		Substrate binding. /evidence=ECO:0000250\|UniProtKB:O95989	38..40
		Nudix box	50..71		6/20 (30%)
		Substrate binding. /evidence=ECO:0000250\|UniProtKB:O95989	89..91		0/1 (0%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	144..164
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0494
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900