DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and DCP2

DIOPT Version :10

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_309532.5 Gene:DCP2 / 1270811 VectorBaseID:AGAMI1_002846 Length:532 Species:Anopheles gambiae


Alignment Length:35 Identity:13/35 - (37%)
Similarity:21/35 - (60%) Gaps:2/35 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 FTQIVELLHVPLQSIYTYKTRFEQSIKQPQFLPGD 327
            ||::..:..|||.:::..|||.|  ||..::.|.|
Mosquito   197 FTRLYLVPGVPLATVFVPKTRNE--IKCCEWFPVD 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:406365
NUDIX_Tnr3_like 131..282 CDD:467544
DCP2XP_309532.5 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.