DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and NUDT5

DIOPT Version :9

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_054861.2 Gene:NUDT5 / 11164 HGNCID:8052 Length:219 Species:Homo sapiens


Alignment Length:260 Identity:49/260 - (18%)
Similarity:78/260 - (30%) Gaps:92/260 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 FRDYNERTEQLEKVLRNLRSE------GLFPALQGWRDEYFEVKADCRALLKMERAATPLFGVRK 136
            :.|...:|...|.|.|..|.|      .:.|.||  |..::|    |..|:|.            
Human    36 YMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQ--RTLHYE----CIVLVKQ------------ 82

  Fly   137 YGVDINGYVRHPTLGLCIWLQQRSNTKETWPGKWDNMVGGGLSVGFGIKETAIKEAAEEASIPSD 201
                    .|.|..|.||                 ....|.:..|...:..|::|..||.....|
Human    83 --------FRPPMGGYCI-----------------EFPAGLIDDGETPEAAALRELEEETGYKGD 122

  Fly   202 LVKNLVSAGCVSFYFESRQGLFPNTEYVFDLELPLDFV------PQNADGEVQAFELLTAKDCVE 260
            :.: ...|.|:.      .||...|.::..:.:..|..      |:..|||......|...|.::
Human   123 IAE-CSPAVCMD------PGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQ 180

  Fly   261 RVFTSDFKTTSAPVVIDFLIRHGHITADDVVDFTQIVELLHVPLQSIYTYKTRFEQSIKQPQFLP 325
            |              :|.|:...|:|.|                ..:|:|....:.:..:|..:|
Human   181 R--------------LDALVAEEHLTVD----------------ARVYSYALALKHANAKPFEVP 215

  Fly   326  325
            Human   216  215

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:292538 15/63 (24%)
Nudix_hydrolase_3 106..283 CDD:239648 32/182 (18%)