DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and NUDT4

DIOPT Version :9

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_950241.1 Gene:NUDT4 / 11163 HGNCID:8051 Length:181 Species:Homo sapiens


Alignment Length:102 Identity:26/102 - (25%)
Similarity:39/102 - (38%) Gaps:16/102 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 RKYGVDINGYVRHPTLGLCIWLQQRSN----TKETWPGKWDNMVGGGLSVGFGIKETAIKEAAEE 195
            |.|  |..|:.:.... ||...:|...    :...:|.:| .:.|||:.........|::|..||
Human    10 RTY--DREGFKKRAAC-LCFRSEQEDEVLLVSSSRYPDQW-IVPGGGMEPEEEPGGAAVREVYEE 70

  Fly   196 ASIPSDLVKNLVSAGCVSFYFESRQGLFPNTEYVFDL 232
            |.:...|       |.:...||..|.....| ||:.|
Human    71 AGVKGKL-------GRLLGIFEQNQDRKHRT-YVYVL 99

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity