powered by:
Protein Alignment CG12567 and nudt7
DIOPT Version :9
Sequence 1: | NP_001015384.1 |
Gene: | CG12567 / 3355094 |
FlyBaseID: | FBgn0039958 |
Length: | 349 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005163269.1 |
Gene: | nudt7 / 100329471 |
ZFINID: | ZDB-GENE-131127-212 |
Length: | 224 |
Species: | Danio rerio |
Alignment Length: | 66 |
Identity: | 21/66 - (31%) |
Similarity: | 29/66 - (43%) |
Gaps: | 16/66 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 187 TAIKEAAEEASIPSDLVK------------NLVSAGCVSFYFES-RQGLFP-NTEYVFDLELPLD 237
||::||.||..:|:|..: .|:....|:|...| |..:.| ....|| .||||
Zfish 80 TALREAEEEIGLPADAAQVIATLFPVINKAGLLITPVVAFIQSSFRPSINPQEVSEVF--TLPLD 142
Fly 238 F 238
|
Zfish 143 F 143
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0494 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.