DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12567 and nudt7

DIOPT Version :10

Sequence 1:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_005163269.1 Gene:nudt7 / 100329471 ZFINID:ZDB-GENE-131127-212 Length:224 Species:Danio rerio


Alignment Length:66 Identity:21/66 - (31%)
Similarity:29/66 - (43%) Gaps:16/66 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 TAIKEAAEEASIPSDLVK------------NLVSAGCVSFYFES-RQGLFP-NTEYVFDLELPLD 237
            ||::||.||..:|:|..:            .|:....|:|...| |..:.| ....||  .||||
Zfish    80 TALREAEEEIGLPADAAQVIATLFPVINKAGLLITPVVAFIQSSFRPSINPQEVSEVF--TLPLD 142

  Fly   238 F 238
            |
Zfish   143 F 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12567NP_001015384.1 DUF4743 11..136 CDD:406365
NUDIX_Tnr3_like 131..282 CDD:467544 21/66 (32%)
nudt7XP_005163269.1 NUDIX_CoAse_Nudt7 31..185 CDD:467532 21/66 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.