DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40470 and Rnpep

DIOPT Version :9

Sequence 1:NP_001036635.1 Gene:CG40470 / 3355093 FlyBaseID:FBgn0058470 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_112359.2 Gene:Rnpep / 81761 RGDID:621137 Length:650 Species:Rattus norvegicus


Alignment Length:319 Identity:53/319 - (16%)
Similarity:115/319 - (36%) Gaps:79/319 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 RRLFPCFDEPGIKVPFNVSIARPKGYITLFNTPLHNTINHPKLRSYSLDFFHTTAPMSTHAFGFV 259
            |..|||||.|.:|..::..:..|.|:..:.:....      :.|..:..||....|:.::.....
  Rat   176 RAFFPCFDTPAVKCTYSALVEVPDGFTAVMSASTW------ERRGPNKFFFQMNQPIPSYLIALA 234

  Fly   260 ILKLHMWNEHKIVKSSDI-PAINIWSNN-LSSTNLLDIQNKLNVAHTTIQHFFNIPLPLTKLDVI 322
            |..|         .|::: |...:|:.. |......:....:.....|.:..|. |....:.|::
  Rat   235 IGDL---------ASAEVGPRSRVWAEPCLIEAAKEEYNGVIEEFLATGEKLFG-PYVWGRYDLL 289

  Fly   323 AIPSLATLPF--------ISASGILIARESEILKKDVFEISRELIYQWIGIWITPEWWTDANVNK 379
            .:|  .:.||        ...:..|:|.:..:....:.|||    :.|.|..:|...|.:..:|:
  Rat   290 FMP--PSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEIS----HSWFGNLVTNANWGEFWLNE 348

  Fly   380 ALISFIASEIVFEINGGIEFNGKYPMTILYSLYY---------ELSKRYPNSHITGIKHEFASIK 435
            ....:....|               .|||:...|         .|.:::.:  ::|.::....::
  Rat   349 GFTMYAQRRI---------------STILFGAAYTCLEAATGRALLRQHMD--VSGEENPLNKLR 396

  Fly   436 VQL--------------------IIRMLSLTVG-KYTFRLGIQSFICDYKFKTYKSSDF 473
            |::                    .:..|:..|| :..|...:::::.::||::..:.||
  Rat   397 VKIEPGVDPDDTYNETPYEKGYCFVSYLAHLVGDQEQFDKFLKAYVDEFKFQSILAEDF 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40470NP_001036635.1 GluZincin 60..503 CDD:301352 53/319 (17%)
ERAP1_C 584..906 CDD:288671
RnpepNP_112359.2 M1_LTA4H 24..484 CDD:341062 53/319 (17%)
Substrate binding. /evidence=ECO:0000250 298..302 0/3 (0%)
Leuk-A4-hydro_C 530..645 CDD:401171
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.