DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40470 and RNPEP

DIOPT Version :9

Sequence 1:NP_001036635.1 Gene:CG40470 / 3355093 FlyBaseID:FBgn0058470 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_064601.3 Gene:RNPEP / 6051 HGNCID:10078 Length:650 Species:Homo sapiens


Alignment Length:321 Identity:56/321 - (17%)
Similarity:112/321 - (34%) Gaps:83/321 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 RRLFPCFDEPGIKVPFNVSIARPKGYITLFNTPLHNTINHPKLRSYSLDFFHTTAPMSTHAFGFV 259
            |..|||||.|.:|..::..|..|.|:..:.:....      :.|..:..||....|:.::.....
Human   176 RAFFPCFDTPAVKYKYSALIEVPDGFTAVMSASTW------EKRGPNKFFFQMCQPIPSYLIALA 234

  Fly   260 ILKLHMWNEHKIVKSSDIPAINIWSNNLSSTNLLDIQNKLNVAHTTIQHFFNI------PLPLTK 318
            |        ..:|.:...|...:|:...    |:|...:  ..:..|:.|...      |....:
Human   235 I--------GDLVSAEVGPRSRVWAEPC----LIDAAKE--EYNGVIEEFLATGEKLFGPYVWGR 285

  Fly   319 LDVIAIPSLATLPF--------ISASGILIARESEILKKDVFEISRELIYQWIGIWITPEWWTDA 375
            .|::.:|  .:.||        ...:..|:|.:..:....:.|||    :.|.|..:|...|.:.
Human   286 YDLLFMP--PSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEIS----HSWFGNLVTNANWGEF 344

  Fly   376 NVNKALISFIASEIVFEINGGIEFNGKYPMTILYSLYY-----ELSKRYPNSH--ITGIKHEFAS 433
            .:|:....:....|               .|||:...|     ...:.....|  |||.::....
Human   345 WLNEGFTMYAQRRI---------------STILFGAAYTCLEAATGRALLRQHMDITGEENPLNK 394

  Fly   434 IKVQL--------------------IIRMLSLTVG-KYTFRLGIQSFICDYKFKTYKSSDF 473
            ::|::                    .:..|:..|| :..|...:::::.::||::..:.||
Human   395 LRVKIEPGVDPDDTYNETPYEKGFCFVSYLAHLVGDQDQFDSFLKAYVHEFKFRSILADDF 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40470NP_001036635.1 GluZincin 60..503 CDD:301352 56/321 (17%)
ERAP1_C 584..906 CDD:288671
RNPEPNP_064601.3 leuko_A4_hydro 24..634 CDD:274120 56/321 (17%)
M1_LTA4H 24..484 CDD:189006 56/321 (17%)
Substrate binding. /evidence=ECO:0000250 298..302 0/3 (0%)
Leuk-A4-hydro_C 504..644 CDD:286244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.