DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40470 and rnpepl1

DIOPT Version :9

Sequence 1:NP_001036635.1 Gene:CG40470 / 3355093 FlyBaseID:FBgn0058470 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_001335117.1 Gene:rnpepl1 / 100535895 ZFINID:ZDB-GENE-030131-5522 Length:692 Species:Danio rerio


Alignment Length:211 Identity:44/211 - (20%)
Similarity:86/211 - (40%) Gaps:31/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 RRLFPCFDEPGIKVPFNVSIARPKGYITLFNTPLHNTINHPKLRSYSLDFFHTTAPMSTHAFGFV 259
            |..|||||.|.:|..::.::..|:|...|.:..........::..:|:::     |:..:....|
Zfish   181 RSFFPCFDTPAVKSTYSATVRVPEGVTVLMSASRSAYSKQDRVFQFSMEY-----PVPAYLVALV 240

  Fly   260 ILKLHMWNEHKIVKSSDI-PAINIWSNNLSSTNLL-----DIQNKLNVAHTTIQHFFNIPLPLTK 318
            ...|    :|     :|| |...:|:.....|..:     .::..||||    :..|. |....:
Zfish   241 AGDL----QH-----ADIGPRSRVWAEPCILTCAVSKLGGSVERWLNVA----EGLFG-PYVWGR 291

  Fly   319 LDVIAIPSLATLPFISASG-ILIARESEILKKDVF---EISRELIYQWIGIWITPEWWTDANVNK 379
            .|::.:|  .:.|.::... .|....|.||:...|   ::..|:.:.|.|..:|...|.:..:::
Zfish   292 YDLVFLP--PSFPIVAMENPCLTFIISSILESQEFLLIDVIHEIAHGWFGNAVTNATWEEMWLSE 354

  Fly   380 ALISFIASEIVFEING 395
            .|.::....|..|..|
Zfish   355 GLATYAQRRITTEAYG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40470NP_001036635.1 GluZincin 60..503 CDD:301352 44/211 (21%)
ERAP1_C 584..906 CDD:288671
rnpepl1NP_001335117.1 M1_LTA4H 36..490 CDD:189006 44/211 (21%)
Leuk-A4-hydro_C 507..649 CDD:312599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.