DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS5 and AT1G64880

DIOPT Version :9

Sequence 1:NP_001036652.1 Gene:mRpS5 / 3355089 FlyBaseID:FBgn0287187 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_564842.1 Gene:AT1G64880 / 842796 AraportID:AT1G64880 Length:515 Species:Arabidopsis thaliana


Alignment Length:246 Identity:63/246 - (25%)
Similarity:105/246 - (42%) Gaps:53/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 NENLDRENGI--LKLRDSMGSFKLMKLNPIDR-------------GWSGSKMPGRSIGPPDPVGD 165
            |::.|.|...  :|.||.:   .|.|||.||:             |..|.::            :
plant   283 NDDDDDEEEFDDMKERDDI---LLEKLNAIDKKLEIKLSELDHTFGKKGKRL------------E 332

  Fly   166 EEF--------------------VSFDTRVLE-NKIVFIMKGNMGRKRRYSVLSVTGNGNGLAGF 209
            ||.                    ..:|..|:: .|:..:.||  ||..||:.|.|.||..|:.|:
plant   333 EEIRELAEDRNALTEKKRQPLYRKGYDVHVIDVKKVCKVTKG--GRVERYTALMVCGNYEGIIGY 395

  Fly   210 ATAKAPEVRTALRKSKNRAGQKLINISLCENRTIFHDFRTDFGKTKIFCFQKPDGYGLVCHRAIQ 274
            |.|||...::|::|:..:..|.|..:...|..||.|..:|.:.|||::.:..|...|:...|.::
plant   396 AKAKAETGQSAMQKAYEKCFQNLHYVERHEEHTIAHAIQTSYKKTKLYLWPAPTTTGMKAGRVVK 460

  Fly   275 TICKVIGIKDLYAKIEGSTNIQNIAKAFFIGLMTQRSYQYIANETNSNIVQ 325
            ||..:.|.|::.:|:.||.|..|..||....|....:.:.:..:....:|:
plant   461 TILLLAGFKNIKSKVIGSRNSYNTVKAVLKALNAVETPKDVQEKFGRTVVE 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS5NP_001036652.1 Ribosomal_S5 171..235 CDD:278748 23/64 (36%)
rpsE_bact 178..323 CDD:130093 44/144 (31%)
Ribosomal_S5_C 251..318 CDD:281681 18/66 (27%)
AT1G64880NP_564842.1 RpsE 362..511 CDD:223176 45/150 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003644
OrthoInspector 1 1.000 - - otm2859
orthoMCL 1 0.900 - - OOG6_104516
Panther 1 1.100 - - O PTHR13718
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.