DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap25 and SNAP23

DIOPT Version :9

Sequence 1:NP_001036641.1 Gene:Snap25 / 3355084 FlyBaseID:FBgn0011288 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_016878181.1 Gene:SNAP23 / 8773 HGNCID:11131 Length:224 Species:Homo sapiens


Alignment Length:200 Identity:100/200 - (50%)
Similarity:129/200 - (64%) Gaps:31/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EELQINAQGVADESLESTRRMLALCEESKEAGIRTLVALDDQGEQLDRIEEGMDQINADMREAEK 83
            ||:|..|..:.|||||||||:|.|..||::|||:|:..||:|.|||:|||||:||||.||||.||
Human     7 EEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLDQINKDMRETEK 71

  Fly    84 NLSGMEKCCGICVLPCNK--------------SQSFKEDDGTWKGNDDGK-----VVNNQPQRVM 129
            .|:.:.||||:||.|||:              .:|.|....||  .|.|:     ||:.||..| 
Human    72 TLTELNKCCGLCVCPCNRFSDVGCFYETRTKNFESGKAYKTTW--GDGGENSPCNVVSKQPGPV- 133

  Fly   130 DDRNGMM-------AQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQID 187
              .||.:       |..|||.||||||||||||||:.||.:::|||::|||::|:|::.||.||.
Human   134 --TNGQLQQPTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIK 196

  Fly   188 RINRK 192
            ||..|
Human   197 RITDK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap25NP_001036641.1 SNARE_SNAP25N_23N 28..87 CDD:277242 39/58 (67%)
SNAP-25 98..149 CDD:279208 24/76 (32%)
SNARE_SNAP25C 151..209 CDD:277238 23/41 (56%)
SNAP23XP_016878181.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156686
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60093
OrthoDB 1 1.010 - - D495812at33208
OrthoFinder 1 1.000 - - FOG0000822
OrthoInspector 1 1.000 - - mtm8607
orthoMCL 1 0.900 - - OOG6_102919
Panther 1 1.100 - - O PTHR19305
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3593
SonicParanoid 1 1.000 - - X1125
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.750

Return to query results.
Submit another query.