DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap25 and SPO20

DIOPT Version :9

Sequence 1:NP_001036641.1 Gene:Snap25 / 3355084 FlyBaseID:FBgn0011288 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_013730.1 Gene:SPO20 / 855031 SGDID:S000004619 Length:397 Species:Saccharomyces cerevisiae


Alignment Length:238 Identity:57/238 - (23%)
Similarity:95/238 - (39%) Gaps:45/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SEEVAPQVPKTE----LEELQINAQGVAD-----------ESLESTRRMLALCEESKEAGIRTLV 55
            :|...||..|.|    ||.:|.....:.|           :|:::|.|.|....|::..|.|.|.
Yeast   144 NENDYPQWRKVESQYNLENVQPEEDEIVDRLRSEIRSTKLKSVKTTSRTLEKAIEARCTGKRVLQ 208

  Fly    56 ALDDQGEQLDRIEEGMDQINADMREAEKNLSGM-EKCCGICVL----PCNKSQSFKEDDGTWKGN 115
            .|..|..||.:||...|.:......|::.:..: .:...:..|    |..|.:..::.|..:...
Yeast   209 QLSCQSNQLTKIESNCDMLKIQSNVADRKIDELAHENRSLLALKSPNPFRKKREREKRDQIYNLK 273

  Fly   116 DDGKVVNNQP-QRVMD-DRN---GMMAQAGYIG------RITNDAR--------EDEMEE----- 156
            ...:.:..:. :|..| |:|   .:.::.|..|      ||..||:        ||...|     
Yeast   274 LKHRHLQQETMKRAQDSDKNLAINLSSEYGRYGQGVERQRILRDAQKYQFEADEEDNQMEIDLYG 338

  Fly   157 NMGQVNTMIGNLRNMALDMGSELENQN-RQIDRINRKGESNEA 198
            |:.|:..:.|:|:.||...|.|.|.|| |..|..|...:::.|
Yeast   339 NLEQIKAVSGDLKIMAHAFGREFEAQNTRMFDIENNVQQADNA 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap25NP_001036641.1 SNARE_SNAP25N_23N 28..87 CDD:277242 17/69 (25%)
SNAP-25 98..149 CDD:279208 11/61 (18%)
SNARE_SNAP25C 151..209 CDD:277238 18/54 (33%)
SPO20NP_013730.1 SNARE_SEC9N 176..245 CDD:277239 16/68 (24%)
t_SNARE 327..392 CDD:197699 18/55 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000822
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.