DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap25 and SNAP30

DIOPT Version :9

Sequence 1:NP_001036641.1 Gene:Snap25 / 3355084 FlyBaseID:FBgn0011288 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001318998.1 Gene:SNAP30 / 837948 AraportID:AT1G13890 Length:263 Species:Arabidopsis thaliana


Alignment Length:218 Identity:61/218 - (27%)
Similarity:103/218 - (47%) Gaps:45/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EELQINAQGVADESLESTRRMLALCEESKEAGIRTLVALDDQGEQLDRIEEGMDQINADMREAEK 83
            |||:..|...|:|:.:.....|.:.|:.:..|.|||..|..||||::|..|....::.|:...||
plant    64 EELEKYAVYKAEETTKGVNNCLKIAEDIRSDGARTLEMLHQQGEQINRTHEMAVDMDKDLSRGEK 128

  Fly    84 ---NLSGM----------EKCCGICVL---PCNKSQSFKEDD-----GTWKGNDDGKVVNNQP-- 125
               ||.||          :...|..:.   |..||::.||:.     |. ||....:...:||  
plant   129 LLNNLGGMFSKPWKPKKTKNITGPMITPDKPSKKSENHKEEREKLGLGA-KGRSSSQPALDQPTN 192

  Fly   126 --QRVMDDRNGMMAQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQIDR 188
              |:|..::                |::|   :.:..::.::|:|::||:|||||::.||:.:|.
plant   193 ALQKVEQEK----------------AKQD---DGLSDLSDILGDLKSMAVDMGSEIDKQNKALDH 238

  Fly   189 INRKGESNEARIAVANQRAHQLL 211
            :....:...:|:..|||||..||
plant   239 LGDDVDELNSRVQGANQRARHLL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap25NP_001036641.1 SNARE_SNAP25N_23N 28..87 CDD:277242 20/61 (33%)
SNAP-25 98..149 CDD:279208 12/59 (20%)
SNARE_SNAP25C 151..209 CDD:277238 19/57 (33%)
SNAP30NP_001318998.1 SNARE_SNAP25N_23N_29N_SEC9N 68..132 CDD:277214 19/63 (30%)
SNARE_Qc 201..259 CDD:277194 20/76 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2314
OMA 1 1.010 - - QHG60093
OrthoDB 1 1.010 - - D1197028at2759
OrthoFinder 1 1.000 - - FOG0000822
OrthoInspector 1 1.000 - - mtm952
orthoMCL 1 0.900 - - OOG6_102919
Panther 1 1.100 - - O PTHR19305
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.